PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011093932.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 416aa    MW: 45801.1 Da    PI: 7.001
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011093932.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.82e-40139216178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +CqvegC+ dl++ak+yhrrh++Ce hsk+p+v+vsg+e rfCqqCsrfh+lsefD++krsCrrrL++hn+rrr+ q+
  XP_011093932.1 139 CCQVEGCNLDLKSAKDYHRRHRICESHSKSPKVIVSGMELRFCQQCSRFHDLSEFDDKKRSCRRRLSDHNARRRRMQP 216
                     6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.6E-35133201IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.188137214IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.18E-38138219IPR004333Transcription factor, SBP-box
PfamPF031101.1E-32140213IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MERNSVSSSG LEWENLAVEI AEPVGFSISM SSSGSNGPLC GDISASALES TKETMDCFGR  60
LGSLPQYDDV IRMQNIREPI SSPSAGSGEP MIGLRLGRPK ELGDSFPTSS TKTSTSSLPT  120
SLTPIKRSRA SYQNMQNPCC QVEGCNLDLK SAKDYHRRHR ICESHSKSPK VIVSGMELRF  180
CQQCSRFHDL SEFDDKKRSC RRRLSDHNAR RRRMQPEAVQ LSSSGLSSAL YDRRVQHVLS  240
GLPIVSLPNS TWESASSVML GQAGDSLIRP SKVGTFDGTL CFPSNDIYCS DANRRVDPER  300
LPSIHSSNHG VLDQCLHLPT NNSPIAPNML SAHSLLSSNS WSLNDVASNS MESLTHGNYN  360
PLLRSSQLES HHLSLFQSNN IPSDQEPLVH SVTLQEYQLF KAPYDSGDFF SSQTNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-291402131184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195212KKRSCRRRLSDHNARRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093932.10.0PREDICTED: squamosa promoter-binding-like protein 12
TrEMBLF6H9P08e-95F6H9P0_VITVI; Putative uncharacterized protein
STRINGVIT_11s0065g00170.t012e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA136441216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.33e-45squamosa promoter binding protein-like 2